PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013590896.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 247aa    MW: 28290.6 Da    PI: 6.5185
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013590896.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.31.3e-161663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++eEd++l+  ++++G ++W++ ++  g+ R++k+c++rw +yl
   XP_013590896.1 16 RGPWSPEEDLKLISFIQKFGHENWRSLPKQSGLLRCGKSCRLRWINYL 63
                     89******************************99************97 PP

2Myb_DNA-binding52.79.7e-1769112146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++T+eE+e ++++++ +G++ W++Ia+ ++ gRt++++k+ w++
   XP_013590896.1  69 RGNFTAEEEETIIKLHQNYGNK-WSRIASQLP-GRTDNEIKNVWHT 112
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-24766IPR009057Homeodomain-like
PROSITE profilePS5129415.4111163IPR017930Myb domain
SuperFamilySSF466894.58E-3014110IPR009057Homeodomain-like
SMARTSM007172.4E-131565IPR001005SANT/Myb domain
PfamPF002493.8E-151663IPR001005SANT/Myb domain
CDDcd001677.09E-101863No hitNo description
PROSITE profilePS5129425.19564118IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-2767119IPR009057Homeodomain-like
SMARTSM007174.1E-1468116IPR001005SANT/Myb domain
PfamPF002494.1E-1569112IPR001005SANT/Myb domain
CDDcd001671.21E-971114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MGKGRAPCCD KTKVKRGPWS PEEDLKLISF IQKFGHENWR SLPKQSGLLR CGKSCRLRWI  60
NYLRPDVKRG NFTAEEEETI IKLHQNYGNK WSRIASQLPG RTDNEIKNVW HTRLKKRLVQ  120
SSETSPCSSN SVSCGKEDKS QAEGCLNKKT SQDFTTSVSS GGSYNSNQED DPKIGLLFKY  180
SVFNDIIQEV DKPDLLEIPF DSDPDIWSFL DSSNSLQQSG ANEFRAEQES DEDEVKKWFK  240
HMESELE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-26161187108B-MYB
1gv2_A4e-26161184105MYB PROTO-ONCOGENE PROTEIN
1mse_C4e-26161184105C-Myb DNA-Binding Domain
1msf_C4e-26161184105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00249DAPTransfer from AT1G79180Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2324450.0AC232445.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB006F18, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013590896.10.0PREDICTED: myb-related protein Zm1-like
RefseqXP_013701293.10.0PREDICTED: myb-related protein Zm1-like
TrEMBLA0A078CR120.0A0A078CR12_BRANA; BnaC06g19980D protein
TrEMBLA0A0D3CVU80.0A0A0D3CVU8_BRAOL; Uncharacterized protein
STRINGBra003619.1-P1e-177(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79180.11e-134myb domain protein 63